Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain [117522] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [117523] (2 PDB entries) Uniprot P21874 |
Domain d1w85d1: 1w85 D:1-192 [114339] Other proteins in same PDB: d1w85a_, d1w85b2, d1w85c_, d1w85d2, d1w85e_, d1w85f2, d1w85g_, d1w85h2, d1w85i_, d1w85j_ |
PDB Entry: 1w85 (more details), 2 Å
SCOP Domain Sequences for d1w85d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w85d1 c.36.1.7 (D:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr qevpegeytipi
Timeline for d1w85d1: