SCOP 1.73: Domain d1w85d1: 1w85 D:1-192

Lineage for d1w85d1 (1w85 D:1-192)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain [117522] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117523] (2 PDB entries)

8. Domain d1w85d1: 1w85 D:1-192 [114339]
   Other proteins in same PDB: d1w85a_, d1w85b2, d1w85c_, d1w85d2, d1w85e_, d1w85f2, d1w85g_, d1w85h2, d1w85i_, d1w85j_

Details for d1w85d1

PDB Entry: 1w85, 2 Å

PDB Description: the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2

PDB Compounds: (D:) pyruvate dehydrogenase e1 component, beta subunit

SCOP Domain Sequences for d1w85d1:

Sequence; same for both SEQRES and ATOM records:

>d1w85d1 c.36.1.7 (D:1-192) Pyruvate dehydrogenase E1-beta, PdhB, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
aqmtmvqaitdalrielkndpnvlifgedvgvnggvfrateglqaefgedrvfdtplaes
gigglaiglalqgfrpvpeiqffgfvyevmdsicgqmariryrtggryhmpitirspfgg
gvhtpelhsdsleglvaqqpglkvvipstpydakgllisairdndpviflehlklyrsfr
qevpegeytipi

Timeline for d1w85d1:

• d1w85d1 first appeared in SCOP 1.71
  
• d1w85d1 appears in SCOP 1.75
  
• d1w85d1 appears in the current release, SCOPe 2.08