SCOPe 2.08: Domain d1tn6b_: 1tn6 B:

Lineage for d1tn6b_ (1tn6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
   Uniprot P49356

8. Domain d1tn6b_: 1tn6 B: [112528]
   Other proteins in same PDB: d1tn6a_
   complexed with acy, fii, zn

Details for d1tn6b_

PDB Entry: 1tn6, 1.8 Å

PDB Description: protein farnesyltransferase complexed with a rap2a peptide substrate and a fpp analog at 1.8a resolution

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1tn6b_:

Sequence; same for both SEQRES and ATOM records:

>d1tn6b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

Timeline for d1tn6b_:

• d1tn6b_ first appeared in SCOP 1.71
  
• d1tn6b_ appears in SCOPe 2.07