Lineage for d1tn6b_ (1tn6 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335726Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2335727Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2335728Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 2335732Domain d1tn6b_: 1tn6 B: [112528]
    Other proteins in same PDB: d1tn6a_
    complexed with acy, fii, suc, zn

Details for d1tn6b_

PDB Entry: 1tn6 (more details), 1.8 Å

PDB Description: protein farnesyltransferase complexed with a rap2a peptide substrate and a fpp analog at 1.8a resolution
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1tn6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tn6b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

SCOPe Domain Coordinates for d1tn6b_:

Click to download the PDB-style file with coordinates for d1tn6b_.
(The format of our PDB-style files is described here.)

Timeline for d1tn6b_: