SCOPe 2.08: Domain d1svla_: 1svl A:

Lineage for d1svla_ (1svl A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Papillomavirus large T antigen helicase domain [89688] (1 species)

7. Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
   Uniprot P03070 265-627

8. Domain d1svla_: 1svl A: [112123]
   complexed with adp, mg, zn
   has additional subdomain(s) that are not in the common domain

Details for d1svla_

PDB Entry: 1svl, 1.95 Å

PDB Description: Co-crystal structure of SV40 large T antigen helicase domain and ADP

PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d1svla_:

Sequence; same for both SEQRES and ATOM records:

>d1svla_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
vld

Timeline for d1svla_:

• d1svla_ first appeared in SCOP 1.71
  
• d1svla_ appears in SCOPe 2.07