SCOP 1.75: Domain d1wlqa_: 1wlq A:

Lineage for d1wlqa_ (1wlq A:)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family)

5. Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)

6. Protein Geminin coiled-coil domain [111471] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
   Uniprot O88513 79-156

8. Domain d1wlqa_: 1wlq A: [109398]
   Other proteins in same PDB: d1wlqc_, d1wlqf_

Details for d1wlqa_

PDB Entry: 1wlq, 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex

PDB Compounds: (A:) Geminin

SCOP Domain Sequences for d1wlqa_:

Sequence; same for both SEQRES and ATOM records:

>d1wlqa_ h.1.28.1 (A:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
kenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqy
maevierlsn

Timeline for d1wlqa_:

• d1wlqa_ first appeared in SCOP 1.69
  
• d1wlqa_ appears in SCOP 1.73
  
• d1wlqa_ does not appear in SCOPe 2.01