PDB entry 1wlq

View 1wlq on RCSB PDB site
Description: Strucure of Geminin-Cdt1 complex
Class: Cell cycle
Keywords: coiled-coil, Cell cycle
Deposited on 2004-06-29, released 2004-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2009-02-17, with a file datestamp of 2009-02-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqa_
  • Chain 'B':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqb_
  • Chain 'C':
    Compound: CDT1 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqc_
  • Chain 'D':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqd_
  • Chain 'E':
    Compound: Geminin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqe_
  • Chain 'F':
    Compound: CDT1 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlqf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlqA (A:)
    gshmtqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrke
    nkdlaevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqA (A:)
    kenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqy
    maevierlsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlqB (B:)
    gshmtqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrke
    nkdlaevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqB (B:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wlqC (C:)
    gshmteqpcvekapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetv
    tfakvkqgvqemmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepl
    lgqeaggatqltatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprf
    nvdevpdiepaelpqppvtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqC (C:)
    kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
    mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqegatqlta
    tcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepael
    pqppv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wlqD (D:)
    gshmtqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrke
    nkdlaevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqD (D:)
    sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
    erlsn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wlqE (E:)
    gshmtqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrke
    nkdlaevaehvqymaevierlsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqE (E:)
    tqeafdliskenpssqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdl
    aevaehvqymaevierls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wlqF (F:)
    gshmteqpcvekapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetv
    tfakvkqgvqemmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepl
    lgqeaggatqltatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprf
    nvdevpdiepaelpqppvtek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlqF (F:)
    kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
    mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqeatqltat
    cllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepaelp
    qppv