Lineage for d1wlqd_ (1wlq D:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895754Superfamily h.1.28: Geminin coiled-coil domain [111469] (1 family) (S)
  5. 895755Family h.1.28.1: Geminin coiled-coil domain [111470] (1 protein)
  6. 895756Protein Geminin coiled-coil domain [111471] (2 species)
  7. 895762Species Mouse (Mus musculus) [TaxId:10090] [111473] (1 PDB entry)
    Uniprot O88513 79-156
  8. 895765Domain d1wlqd_: 1wlq D: [109401]
    Other proteins in same PDB: d1wlqc_, d1wlqf_

Details for d1wlqd_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex
PDB Compounds: (D:) Geminin

SCOP Domain Sequences for d1wlqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlqd_ h.1.28.1 (D:) Geminin coiled-coil domain {Mouse (Mus musculus) [TaxId: 10090]}
sqywkevaeqrrkalyealkeneklhkeieqkdseiarlrkenkdlaevaehvqymaevi
erlsn

SCOP Domain Coordinates for d1wlqd_:

Click to download the PDB-style file with coordinates for d1wlqd_.
(The format of our PDB-style files is described here.)

Timeline for d1wlqd_: