Lineage for d1wlqc_ (1wlq C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762834Family a.4.5.52: DNA replication factor Cdt1 [109686] (1 protein)
  6. 762835Protein DNA replication factor Cdt1 [109687] (1 species)
  7. 762836Species Mouse (Mus musculus) [TaxId:10090] [109688] (1 PDB entry)
    Uniprot Q8R4E9 179-365
  8. 762837Domain d1wlqc_: 1wlq C: [109400]
    Other proteins in same PDB: d1wlqa_, d1wlqb_, d1wlqd_, d1wlqe_

Details for d1wlqc_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex
PDB Compounds: (C:) CDT1 protein

SCOP Domain Sequences for d1wlqc_:

Sequence, based on SEQRES records: (download)

>d1wlqc_ a.4.5.52 (C:) DNA replication factor Cdt1 {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqeaggatql
tatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepa
elpqppv

Sequence, based on observed residues (ATOM records): (download)

>d1wlqc_ a.4.5.52 (C:) DNA replication factor Cdt1 {Mouse (Mus musculus) [TaxId: 10090]}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqegatqlta
tcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepael
pqppv

SCOP Domain Coordinates for d1wlqc_:

Click to download the PDB-style file with coordinates for d1wlqc_.
(The format of our PDB-style files is described here.)

Timeline for d1wlqc_: