Lineage for d1vlgh_ (1vlg H:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485212Protein Non-hem ferritin [63524] (6 species)
  7. 1485293Species Thermotoga maritima [TaxId:2336] [109783] (1 PDB entry)
    Uniprot Q9X0L2
  8. 1485301Domain d1vlgh_: 1vlg H: [108823]
    Structural genomics target
    complexed with fe, gol, so4

Details for d1vlgh_

PDB Entry: 1vlg (more details), 2 Å

PDB Description: crystal structure of ferritin (tm1128) from thermotoga maritima at 2.00 a resolution
PDB Compounds: (H:) Ferritin

SCOPe Domain Sequences for d1vlgh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlgh_ a.25.1.1 (H:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]}
mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy
eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs
flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre

SCOPe Domain Coordinates for d1vlgh_:

Click to download the PDB-style file with coordinates for d1vlgh_.
(The format of our PDB-style files is described here.)

Timeline for d1vlgh_: