![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (3 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (7 proteins) |
![]() | Protein Non-hem ferritin [63524] (3 species) |
![]() | Species Thermotoga maritima [TaxId:243274] [109783] (1 PDB entry) |
![]() | Domain d1vlgh_: 1vlg H: [108823] Structural genomics target |
PDB Entry: 1vlg (more details), 2 Å
SCOP Domain Sequences for d1vlgh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlgh_ a.25.1.1 (H:) Non-hem ferritin {Thermotoga maritima} mmvisekvrkalndqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
Timeline for d1vlgh_: