Lineage for d1vkza1 (1vkz A:314-399)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809036Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1809098Protein Glycinamide ribonucleotide synthetase (GAR-syn), C-domain [51250] (2 species)
  7. 1809101Species Thermotoga maritima [TaxId:2336] [110323] (1 PDB entry)
    Uniprot Q9X0X7
  8. 1809102Domain d1vkza1: 1vkz A:314-399 [108698]
    Other proteins in same PDB: d1vkza2, d1vkza3, d1vkzb2, d1vkzb3
    Structural genomics target
    complexed with edo

Details for d1vkza1

PDB Entry: 1vkz (more details), 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkza1 b.84.2.1 (A:314-399) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Thermotoga maritima [TaxId: 2336]}
gfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmgtgetk
eearrkayelaekvhfegktyrrdia

SCOPe Domain Coordinates for d1vkza1:

Click to download the PDB-style file with coordinates for d1vkza1.
(The format of our PDB-style files is described here.)

Timeline for d1vkza1: