SCOPe 2.05: Domain d1vkzb3: 1vkz B:94-313

Lineage for d1vkzb3 (1vkz B:94-313)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 [56070] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [111187] (1 PDB entry)
   Uniprot Q9X0X7

8. Domain d1vkzb3: 1vkz B:94-313 [108703]
   Other proteins in same PDB: d1vkza1, d1vkza2, d1vkzb1, d1vkzb2
   Structural genomics target
   complexed with edo

Details for d1vkzb3

PDB Entry: 1vkz, 2.3 Å

PDB Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution

PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d1vkzb3:

Sequence; same for both SEQRES and ATOM records:

>d1vkzb3 d.142.1.2 (B:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]}
skvyakrfmkkygirtarfevaetpeelrekikkfsppyvikadglargkgvlildskee
tiekgskliigelikgvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdr
gpntggmgswgpveipsdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyile
ynvrlgdpetevivtlnpegfvnavlegyrggkmepvepr

Timeline for d1vkzb3:

• d1vkzb3 first appeared in SCOP 1.69
  
• d1vkzb3 appears in SCOPe 2.04
  
• d1vkzb3 appears in SCOPe 2.06
  
• d1vkzb3 appears in the current release, SCOPe 2.08