Lineage for d1v3jb4 (1v3j B:1-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830058Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 2830100Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries)
    Uniprot P05618
  8. 2830116Domain d1v3jb4: 1v3j B:1-406 [108312]
    Other proteins in same PDB: d1v3ja1, d1v3ja2, d1v3ja3, d1v3jb1, d1v3jb2, d1v3jb3
    complexed with ca; mutant
    has additional subdomain(s) that are not in the common domain

Details for d1v3jb4

PDB Entry: 1v3j (more details), 2 Å

PDB Description: crystal structure of f283l mutant cyclodextrin glycosyltransferase
PDB Compounds: (B:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d1v3jb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v3jb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldlrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOPe Domain Coordinates for d1v3jb4:

Click to download the PDB-style file with coordinates for d1v3jb4.
(The format of our PDB-style files is described here.)

Timeline for d1v3jb4: