Lineage for d1u1ra_ (1u1r A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027962Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1027963Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1028086Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 1028087Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
    Uniprot P09651 7-188
  8. 1028095Domain d1u1ra_: 1u1r A: [107599]
    protein/DNA complex; protein/RNA complex

Details for d1u1ra_

PDB Entry: 1u1r (more details), 1.8 Å

PDB Description: crystal structure of up1 complexed with d(ttagggttag(2pr)g); a human telomeric repeat containing 2-aminopurine
PDB Compounds: (A:) heterogeneous nuclear ribonucleoprotein a1

SCOPe Domain Sequences for d1u1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ra_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
sas

SCOPe Domain Coordinates for d1u1ra_:

Click to download the PDB-style file with coordinates for d1u1ra_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ra_: