Lineage for d1u1ra_ (1u1r A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504527Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 504528Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 504573Protein Nuclear ribonucleoprotein A1 (RNP A1, UP1) [54930] (1 species)
    duplication: contains two domains of this fold
  7. 504574Species Human (Homo sapiens) [TaxId:9606] [54931] (14 PDB entries)
  8. 504582Domain d1u1ra_: 1u1r A: [107599]

Details for d1u1ra_

PDB Entry: 1u1r (more details), 1.8 Å

PDB Description: crystal structure of up1 complexed with d(ttagggttag(2pr)g); a human telomeric repeat containing 2-aminopurine

SCOP Domain Sequences for d1u1ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u1ra_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens)}
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
sas

SCOP Domain Coordinates for d1u1ra_:

Click to download the PDB-style file with coordinates for d1u1ra_.
(The format of our PDB-style files is described here.)

Timeline for d1u1ra_: