Lineage for d1tzye_ (1tzy E:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082623Protein Histone H2A [47115] (6 species)
  7. 1082697Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 1082699Domain d1tzye_: 1tzy E: [107534]
    Other proteins in same PDB: d1tzyb_, d1tzyc_, d1tzyd_, d1tzyf_, d1tzyg_, d1tzyh_
    complexed with cl, po4

Details for d1tzye_

PDB Entry: 1tzy (more details), 1.9 Å

PDB Description: Crystal Structure of the Core-Histone Octamer to 1.90 Angstrom Resolution
PDB Compounds: (E:) histone h2a-IV

SCOPe Domain Sequences for d1tzye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tzye_ a.22.1.1 (E:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp

SCOPe Domain Coordinates for d1tzye_:

Click to download the PDB-style file with coordinates for d1tzye_.
(The format of our PDB-style files is described here.)

Timeline for d1tzye_: