Lineage for d1tpxc1 (1tpx C:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1756377Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 1756424Domain d1tpxc1: 1tpx C:1-107 [107192]
    Other proteins in same PDB: d1tpxa_, d1tpxb2, d1tpxc2
    MQ P01631 P01837 # ! natural chimera

Details for d1tpxc1

PDB Entry: 1tpx (more details), 2.56 Å

PDB Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody
PDB Compounds: (C:) the VRQ14 Fab

SCOPe Domain Sequences for d1tpxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpxc1 b.1.1.1 (C:1-107) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleik

SCOPe Domain Coordinates for d1tpxc1:

Click to download the PDB-style file with coordinates for d1tpxc1.
(The format of our PDB-style files is described here.)

Timeline for d1tpxc1: