SCOPe 2.06: Domain d1tpxc1: 1tpx C:1-107

Lineage for d1tpxc1 (1tpx C:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1tpxc1: 1tpx C:1-107 [107192]
   Other proteins in same PDB: d1tpxa_, d1tpxb2, d1tpxc2
   MQ P01631 P01837 # ! natural chimera

Details for d1tpxc1

PDB Entry: 1tpx, 2.56 Å

PDB Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody

PDB Compounds: (C:) the VRQ14 Fab

SCOPe Domain Sequences for d1tpxc1:

Sequence; same for both SEQRES and ATOM records:

>d1tpxc1 b.1.1.1 (C:1-107) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dvvmsqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvsrld
sgvpdrftgsgsgtdftlkisrveaedlgiyfcwqgshfpqtfgggtkleik

Timeline for d1tpxc1:

• d1tpxc1 first appeared in SCOP 1.69
  
• d1tpxc1 appears in SCOPe 2.05
  
• d1tpxc1 appears in SCOPe 2.07
  
• d1tpxc1 appears in the current release, SCOPe 2.08