SCOPe 2.05: Domain d1te6a2: 1te6 A:1-139

Lineage for d1te6a2 (1te6 A:1-139)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (9 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries)
   Uniprot P09104

8. Domain d1te6a2: 1te6 A:1-139 [106798]
   Other proteins in same PDB: d1te6a1, d1te6b1
   complexed with cl, mg, po4, trs

Details for d1te6a2

PDB Entry: 1te6, 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

PDB Compounds: (A:) Gamma enolase

SCOPe Domain Sequences for d1te6a2:

Sequence; same for both SEQRES and ATOM records:

>d1te6a2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d1te6a2:

• d1te6a2 first appeared in SCOP 1.69
  
• d1te6a2 appears in SCOPe 2.04
  
• d1te6a2 appears in SCOPe 2.06
  
• d1te6a2 appears in the current release, SCOPe 2.08