SCOP 1.69: Domain d1te6a2: 1te6 A:1-139

Lineage for d1te6a2 (1te6 A:1-139)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (6 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (1 PDB entry)

8. Domain d1te6a2: 1te6 A:1-139 [106798]
   Other proteins in same PDB: d1te6a1, d1te6b1

Details for d1te6a2

PDB Entry: 1te6, 1.8 Å

PDB Description: crystal structure of human neuron specific enolase at 1.8 angstrom

SCOP Domain Sequences for d1te6a2:

Sequence; same for both SEQRES and ATOM records:

>d1te6a2 d.54.1.1 (A:1-139) Enolase {Human (Homo sapiens), gamma isoform}
siekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn

Timeline for d1te6a2:

• d1te6a2 is new in SCOP 1.69
  
• d1te6a2 appears in SCOP 1.71
  
• d1te6a2 appears in the current release, SCOPe 2.08