Lineage for d1tc5c_ (1tc5 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1884365Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 1884366Superfamily c.110.1: DTD-like [69500] (2 families) (S)
    active form is a dimer
  5. 1884367Family c.110.1.1: DTD-like [69501] (2 proteins)
    Pfam PF02580
  6. 1884376Protein probable eukaryotic D-amino acid tRNA deacylase [110589] (1 species)
  7. 1884377Species Leishmania major [TaxId:5664] [110590] (1 PDB entry)
    Uniprot P84066
  8. 1884380Domain d1tc5c_: 1tc5 C: [106754]
    Structural genomics target

Details for d1tc5c_

PDB Entry: 1tc5 (more details), 1.93 Å

PDB Description: structural analysis of a probable eukaryotic d-amino acid trna deacylase
PDB Compounds: (C:) Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA

SCOPe Domain Sequences for d1tc5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tc5c_ c.110.1.1 (C:) probable eukaryotic D-amino acid tRNA deacylase {Leishmania major [TaxId: 5664]}
mtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllht
kifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydr
fchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpf
thmfdi

SCOPe Domain Coordinates for d1tc5c_:

Click to download the PDB-style file with coordinates for d1tc5c_.
(The format of our PDB-style files is described here.)

Timeline for d1tc5c_: