SCOPe 2.04: Domain d1tc5c_: 1tc5 C:

Lineage for d1tc5c_ (1tc5 C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.110: DTD-like [69499] (1 superfamily)
   beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC

4. Superfamily c.110.1: DTD-like [69500] (2 families)
   active form is a dimer

5. Family c.110.1.1: DTD-like [69501] (2 proteins)
   Pfam PF02580

6. Protein probable eukaryotic D-amino acid tRNA deacylase [110589] (1 species)

7. Species Leishmania major [TaxId:5664] [110590] (1 PDB entry)
   Uniprot P84066

8. Domain d1tc5c_: 1tc5 C: [106754]
   Structural genomics target

Details for d1tc5c_

PDB Entry: 1tc5, 1.93 Å

PDB Description: structural analysis of a probable eukaryotic d-amino acid trna deacylase

PDB Compounds: (C:) Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA

SCOPe Domain Sequences for d1tc5c_:

Sequence; same for both SEQRES and ATOM records:

>d1tc5c_ c.110.1.1 (C:) probable eukaryotic D-amino acid tRNA deacylase {Leishmania major [TaxId: 5664]}
mtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllht
kifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydr
fchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpf
thmfdi

Timeline for d1tc5c_:

• d1tc5c_ first appeared in SCOP 1.69
  
• d1tc5c_ appears in SCOPe 2.03
  
• d1tc5c_ appears in SCOPe 2.05
  
• d1tc5c_ appears in the current release, SCOPe 2.08, called d1tc5c1