SCOP 1.73: Domain d1t5xa1: 1t5x A:82-181

Lineage for d1t5xa1 (1t5x A:82-181)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1t5xa1: 1t5x A:82-181 [106489]
   Other proteins in same PDB: d1t5xa2, d1t5xb1, d1t5xb2, d1t5xd1, d1t5xd2
   mutant

Details for d1t5xa1

PDB Entry: 1t5x, 2.5 Å

PDB Description: hla-dr1 in complex with a synthetic peptide (aaysdqatplllspr) and the superantigen sec3-3b2

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOP Domain Sequences for d1t5xa1:

Sequence; same for both SEQRES and ATOM records:

>d1t5xa1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1t5xa1:

• d1t5xa1 first appeared in SCOP 1.69
  
• d1t5xa1 appears in SCOP 1.71
  
• d1t5xa1 appears in SCOP 1.75
  
• d1t5xa1 appears in the current release, SCOPe 2.08