![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88808] (18 PDB entries) Uniprot P01903 28-207 |
![]() | Domain d1t5wd2: 1t5w D:4-81 [106486] Other proteins in same PDB: d1t5wa1, d1t5wb1, d1t5wb2, d1t5wd1, d1t5we1, d1t5we2 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1t5w (more details), 2.4 Å
SCOPe Domain Sequences for d1t5wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t5wd2 d.19.1.1 (D:4-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]} ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani avdkanleimtkrsnytp
Timeline for d1t5wd2: