SCOPe 2.08: Domain d1t3la1: 1t3l A:35-141

Lineage for d1t3la1 (1t3l A:35-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein SH3-like domain of the L-type calcium channel [110158] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries)
   Uniprot P54288

8. Domain d1t3la1: 1t3l A:35-141 [106358]
   Other proteins in same PDB: d1t3la2, d1t3lb_
   has additional insertions and/or extensions that are not grouped together

Details for d1t3la1

PDB Entry: 1t3l, 2.2 Å

PDB Description: structural analysis of the voltage-dependent calcium channel beta subunit functional core in complex with alpha1 interaction domain

PDB Compounds: (A:) Dihydropyridine-sensitive L-type, calcium channel beta-2 subunit

SCOPe Domain Sequences for d1t3la1:

Sequence; same for both SEQRES and ATOM records:

>d1t3la1 b.34.2.1 (A:35-141) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl
hvkekfnndwwigrlvkegceigfipsrvklenmrlqheqrakefkl

Timeline for d1t3la1:

• d1t3la1 first appeared in SCOP 1.69
  
• d1t3la1 appears in SCOPe 2.07