Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110159] (5 PDB entries) Uniprot P54288 |
Domain d1t3la1: 1t3l A:35-141 [106358] Other proteins in same PDB: d1t3la2, d1t3lb_ has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1t3l (more details), 2.2 Å
SCOPe Domain Sequences for d1t3la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3la1 b.34.2.1 (A:35-141) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} eedreavrreaerqaqaqlekaktkpvafavrtnvsysaaheddvpvpgmaisfeakdfl hvkekfnndwwigrlvkegceigfipsrvklenmrlqheqrakefkl
Timeline for d1t3la1: