Lineage for d1t11b1 (1t11 B:248-376)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2019819Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2019820Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2019821Family a.223.1.1: TF C-terminus [109999] (1 protein)
    Pfam PF05698; includes the upstream linker region not covered by the Pfam model
  6. 2019822Protein Trigger factor, C-terminal domain [110000] (2 species)
  7. 2019827Species Vibrio cholerae [TaxId:666] [110002] (1 PDB entry)
    Uniprot Q9KQS5
  8. 2019829Domain d1t11b1: 1t11 B:248-376 [106239]
    Other proteins in same PDB: d1t11a2, d1t11a3, d1t11a4, d1t11b2, d1t11b3, d1t11b4

Details for d1t11b1

PDB Entry: 1t11 (more details), 2.5 Å

PDB Description: trigger factor
PDB Compounds: (B:) Trigger Factor

SCOPe Domain Sequences for d1t11b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t11b1 a.223.1.1 (B:248-376) Trigger factor, C-terminal domain {Vibrio cholerae [TaxId: 666]}
lndefvarfgvaeggvdalkaevrknmerelkqaikarikeqaieglvkeneiqvpsali
dqeinvlrqqaaqrfggnveaaaqlprelfeeqakrrvvvglllgevirthelkadeekv
kalitemat

SCOPe Domain Coordinates for d1t11b1:

Click to download the PDB-style file with coordinates for d1t11b1.
(The format of our PDB-style files is described here.)

Timeline for d1t11b1: