Lineage for d1sm1k_ (1sm1 K:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1971716Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 1971851Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 1971852Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1971896Domain d1sm1k_: 1sm1 K: [105739]
    complexed with dol

Details for d1sm1k_

PDB Entry: 1sm1 (more details), 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin
PDB Compounds: (K:) 50S ribosomal protein L16

SCOPe Domain Sequences for d1sm1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm1k_ i.1.1.2 (K:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

SCOPe Domain Coordinates for d1sm1k_:

Click to download the PDB-style file with coordinates for d1sm1k_.
(The format of our PDB-style files is described here.)

Timeline for d1sm1k_: