Lineage for d1sm1k_ (1sm1 K:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526851Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 526855Protein 50S subunit [58125] (3 species)
  7. 526893Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)
  8. 527000Domain d1sm1k_: 1sm1 K: [105739]

Details for d1sm1k_

PDB Entry: 1sm1 (more details), 3.42 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with quinupristin and dalfopristin

SCOP Domain Sequences for d1sm1k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm1k_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

SCOP Domain Coordinates for d1sm1k_:

Click to download the PDB-style file with coordinates for d1sm1k_.
(The format of our PDB-style files is described here.)

Timeline for d1sm1k_: