Lineage for d1s9ya2 (1s9y A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. Domain d1s9ya2: 1s9y A:1-181 [105398]
    Other proteins in same PDB: d1s9ya1, d1s9yb1, d1s9yb2
    complexed with so4

Details for d1s9ya2

PDB Entry: 1s9y (more details), 2.3 Å

PDB Description: crystal structure analysis of ny-eso-1 epitope analogue, sllmwitqs, in complex with hla-a2
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1s9ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9ya2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1s9ya2 are not available.

Timeline for d1s9ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s9ya1
View in 3D
Domains from other chains:
(mouse over for more information)
d1s9yb1, d1s9yb2