SCOP 1.73: Domain d1r0bj2: 1r0b J:101-153

Lineage for d1r0bj2 (1r0b J:101-153)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (41 PDB entries)

8. Domain d1r0bj2: 1r0b J:101-153 [104702]
   Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg1, d1r0bh1, d1r0bi1, d1r0bj1, d1r0bk1, d1r0bl1

Details for d1r0bj2

PDB Entry: 1r0b, 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate

PDB Compounds: (J:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1r0bj2:

Sequence; same for both SEQRES and ATOM records:

>d1r0bj2 g.41.7.1 (J:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1r0bj2:

• d1r0bj2 first appeared in SCOP 1.69
  
• d1r0bj2 appears in SCOP 1.71
  
• d1r0bj2 appears in SCOP 1.75
  
• d1r0bj2 appears in the current release, SCOPe 2.08