Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins) |
Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species) |
Species Escherichia coli [TaxId:562] [53674] (45 PDB entries) |
Domain d1r0bc1: 1r0b C:1-150 [104687] Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2 |
PDB Entry: 1r0b (more details), 2.9 Å
SCOP Domain Sequences for d1r0bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0bc1 c.78.1.1 (C:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg nvpvlnagdgsnqhptqtlldlftiqetqg
Timeline for d1r0bc1: