Lineage for d1r0bb1 (1r0b B:1-150)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708619Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 708620Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 708621Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 708622Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 708638Species Escherichia coli [TaxId:562] [53674] (45 PDB entries)
  8. 708819Domain d1r0bb1: 1r0b B:1-150 [104685]
    Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2

Details for d1r0bb1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate
PDB Compounds: (B:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d1r0bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bb1 c.78.1.1 (B:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1r0bb1:

Click to download the PDB-style file with coordinates for d1r0bb1.
(The format of our PDB-style files is described here.)

Timeline for d1r0bb1: