SCOPe 2.08: Domain d1ntya2: 1nty A:1415-1535

Lineage for d1ntya2 (1nty A:1415-1535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Triple functional domain protein TRIO [110264] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110265] (3 PDB entries)
   Uniprot O75962 1231-1535

8. Domain d1ntya2: 1nty A:1415-1535 [103874]
   Other proteins in same PDB: d1ntya1

Details for d1ntya2

PDB Entry: 1nty, 1.7 Å

PDB Description: crystal structure of the first dh/ph domain of trio to 1.7 a

PDB Compounds: (A:) triple functional domain protein

SCOPe Domain Sequences for d1ntya2:

Sequence; same for both SEQRES and ATOM records:

>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]}
egfdeniesqgelilqesfqvwdpktlirkgrerhlflfemslvfskevkdssgrskyly
ksklftselgvtehvegdpckfalwvgrtptsdnkivlkassienkqdwikhireviqer
t

Timeline for d1ntya2:

• d1ntya2 first appeared in SCOP 1.69
  
• d1ntya2 appears in SCOPe 2.07