![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Hypothetical transcriptional regulator YsiA [101003] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101004] (1 PDB entry) |
![]() | Domain d1vi0a1: 1vi0 A:6-77 [100720] Other proteins in same PDB: d1vi0a2, d1vi0b2 structural genomics complexed with dcc |
PDB Entry: 1vi0 (more details), 1.65 Å
SCOPe Domain Sequences for d1vi0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]} pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf iermeedikeka
Timeline for d1vi0a1: