Lineage for d1vi0b1 (1vi0 B:6-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692291Protein Hypothetical transcriptional regulator YsiA [101003] (1 species)
  7. 2692292Species Bacillus subtilis [TaxId:1423] [101004] (1 PDB entry)
  8. 2692294Domain d1vi0b1: 1vi0 B:6-77 [100722]
    Other proteins in same PDB: d1vi0a2, d1vi0b2
    structural genomics
    complexed with dcc

Details for d1vi0b1

PDB Entry: 1vi0 (more details), 1.65 Å

PDB Description: crystal structure of a transcriptional regulator
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d1vi0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vi0b1 a.4.1.9 (B:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]}
pkymqiidaaveviaengyhqsqvskiakqagvadgtiylyfknkedilislfkekmgqf
iermeedikeka

SCOPe Domain Coordinates for d1vi0b1:

Click to download the PDB-style file with coordinates for d1vi0b1.
(The format of our PDB-style files is described here.)

Timeline for d1vi0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vi0b2