Lineage for d1vhtc1 (1vht C:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2865946Protein Dephospho-CoA kinase [75187] (4 species)
  7. 2865947Species Escherichia coli [TaxId:562] [82394] (5 PDB entries)
  8. 2865950Domain d1vhtc1: 1vht C:2-206 [100702]
    Other proteins in same PDB: d1vhta2, d1vhta3, d1vhtb2, d1vhtb3, d1vhtc2, d1vhtc3
    structural genomics
    complexed with act, ba3

Details for d1vhtc1

PDB Entry: 1vht (more details), 1.59 Å

PDB Description: crystal structure of dephospho-coa kinase with bis(adenosine)-5'- triphosphate
PDB Compounds: (C:) dephospho-coa kinase

SCOPe Domain Sequences for d1vhtc1:

Sequence, based on SEQRES records: (download)

>d1vhtc1 c.37.1.1 (C:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaa
dgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvensly
kkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngapda
iasdvarlhahylqlasqfvsqekp

Sequence, based on observed residues (ATOM records): (download)

>d1vhtc1 c.37.1.1 (C:2-206) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}
ryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhanmiaadg
tlwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetqlkr
tmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqf
vsqekp

SCOPe Domain Coordinates for d1vhtc1:

Click to download the PDB-style file with coordinates for d1vhtc1.
(The format of our PDB-style files is described here.)

Timeline for d1vhtc1: