Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Dephospho-CoA kinase [75187] (3 species) |
Species Escherichia coli [TaxId:562] [82394] (5 PDB entries) |
Domain d1vhtc_: 1vht C: [100702] structural genomics complexed with act, ba3 |
PDB Entry: 1vht (more details), 1.59 Å
SCOP Domain Sequences for d1vhtc_:
Sequence, based on SEQRES records: (download)
>d1vhtc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli} slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmi aadgtlqrralrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvens lykkanrvlvvdvspetqlkrtmqrddvtrehveqilaaqatrearlavaddvidnngap daiasdvarlhahylqlasqfvsqekpe
>d1vhtc_ c.37.1.1 (C:) Dephospho-CoA kinase {Escherichia coli} slryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhanmiaa dgtlwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetql krtmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlas qfvsqekpe
Timeline for d1vhtc_: