Lineage for d1uura3 (1uur A:577-707)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572198Protein STAT homologue [103137] (1 species)
  7. 2572199Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [103138] (2 PDB entries)
  8. 2572200Domain d1uura3: 1uur A:577-707 [100018]
    Other proteins in same PDB: d1uura1, d1uura2

Details for d1uura3

PDB Entry: 1uur (more details), 2.7 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form
PDB Compounds: (A:) stata protein

SCOPe Domain Sequences for d1uura3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rhistlwqegiiygymgrqevndalqnqdpgtfiirfsernpgqfgiayigvemparikh
ylvqpndtaaakktfpdflsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtap
vpvggyeplns

SCOPe Domain Coordinates for d1uura3:

Click to download the PDB-style file with coordinates for d1uura3.
(The format of our PDB-style files is described here.)

Timeline for d1uura3: