Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein STAT homologue [103137] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [103138] (2 PDB entries) |
Domain d1uura3: 1uur A:577-707 [100018] Other proteins in same PDB: d1uura1, d1uura2 |
PDB Entry: 1uur (more details), 2.7 Å
SCOPe Domain Sequences for d1uura3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} rhistlwqegiiygymgrqevndalqnqdpgtfiirfsernpgqfgiayigvemparikh ylvqpndtaaakktfpdflsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtap vpvggyeplns
Timeline for d1uura3: