Lineage for d1uura2 (1uur A:360-576)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378129Family b.2.5.5: STAT DNA-binding domain [81317] (4 proteins)
  6. 2378130Protein STAT homologue [101554] (1 species)
  7. 2378131Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101555] (2 PDB entries)
  8. 2378132Domain d1uura2: 1uur A:360-576 [100017]
    Other proteins in same PDB: d1uura1, d1uura3

Details for d1uura2

PDB Entry: 1uur (more details), 2.7 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form
PDB Compounds: (A:) stata protein

SCOPe Domain Sequences for d1uura2:

Sequence, based on SEQRES records: (download)

>d1uura2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshptnknn
pttplemdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpf
vvitnecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssyd
lkyiqthffgnrsiihqqdfdkfwvwfgksmqtlryq

Sequence, based on observed residues (ATOM records): (download)

>d1uura2 b.2.5.5 (A:360-576) STAT homologue {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
pnvalvlksqpfpvviskgkqlgenqlvvlvltgarsnfhingpvkatmicdshppttpl
emdsqpiypatltahfplkflagtrkcsvnlkfgvnirdldnvtttvesdasnpfvvitn
ecqwegsagvllkkdafdgqleitwaqfintlqrhfliatkqdpvrpkrplssydlkyiq
thffgnrsiihqqdfdkfwvwfgksmqtlryq

SCOPe Domain Coordinates for d1uura2:

Click to download the PDB-style file with coordinates for d1uura2.
(The format of our PDB-style files is described here.)

Timeline for d1uura2: