SCOP 1.67: Domain d1uura3: 1uur A:577-707

Lineage for d1uura3 (1uur A:577-707)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein STAT homologue [103137] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [103138] (2 PDB entries)

8. Domain d1uura3: 1uur A:577-707 [100018]
   Other proteins in same PDB: d1uura1, d1uura2

Details for d1uura3

PDB Entry: 1uur, 2.7 Å

PDB Description: structure of an activated dictyostelium stat in its dna-unbound form

SCOP Domain Sequences for d1uura3:

Sequence; same for both SEQRES and ATOM records:

>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Slime mold (Dictyostelium discoideum)}
rhistlwqegiiygymgrqevndalqnqdpgtfiirfsernpgqfgiayigvemparikh
ylvqpndtaaakktfpdflsehsqfvnllqwtkdtngaprflklhkdtalgsfapkrtap
vpvggyeplns

Timeline for d1uura3:

• d1uura3 is new in SCOP 1.67
  
• d1uura3 appears in SCOP 1.69
  
• d1uura3 appears in the current release, SCOPe 2.08