Lineage for d6m8fa_ (6m8f A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2688020Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
    Uniprot P02185
  8. 2688032Domain d6m8fa_: 6m8f A: [362764]
    automated match to d2mgja_
    complexed with hem, so4

Details for d6m8fa_

PDB Entry: 6m8f (more details), 1.1 Å

PDB Description: engineered sperm whale myoglobin-based carbene transferase
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6m8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m8fa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d6m8fa_:

Click to download the PDB-style file with coordinates for d6m8fa_.
(The format of our PDB-style files is described here.)

Timeline for d6m8fa_: