Lineage for d5l8rd_ (5l8r D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005547Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 3005548Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 3005549Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 3005562Protein automated matches [236562] (8 species)
    not a true protein
  7. 3005578Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries)
  8. 3005585Domain d5l8rd_: 5l8r D: [341216]
    Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_
    automated match to d4y28d_
    complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8rd_

PDB Entry: 5l8r (more details), 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.
PDB Compounds: (D:) PsaD

SCOPe Domain Sequences for d5l8rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8rd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn
llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn
frsigknvspievkftgkqpydl

SCOPe Domain Coordinates for d5l8rd_:

Click to download the PDB-style file with coordinates for d5l8rd_.
(The format of our PDB-style files is described here.)

Timeline for d5l8rd_: