Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276208] (9 PDB entries) |
Domain d5l8rd_: 5l8r D: [341216] Other proteins in same PDB: d5l8r1_, d5l8r2_, d5l8r3_, d5l8r4_, d5l8ra_, d5l8rb_, d5l8rc_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_ automated match to d4y28d_ complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 5l8r (more details), 2.6 Å
SCOPe Domain Sequences for d5l8rd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8rd_ d.187.1.1 (D:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} gftppeldpntpspifggstggllrkaqveefyvitwespkeqifemptggaaimregpn llklarkeqclalgtrlrskykikyqfyrvfpsgevqylhpkdgvypekvnpgrqgvgvn frsigknvspievkftgkqpydl
Timeline for d5l8rd_: