SCOPe 2.08: Domain d5l8r4_: 5l8r 4:

Lineage for d5l8r4_ (5l8r 4:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)

8. Domain d5l8r4_: 5l8r 4: [341442]
   Other proteins in same PDB: d5l8ra_, d5l8rb_, d5l8rc_, d5l8rd_, d5l8re1, d5l8re2, d5l8rf_, d5l8rj_, d5l8rl_
   automated match to d4y284_
   complexed with bcr, ca, chl, cl0, cla, dgd, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d5l8r4_

PDB Entry: 5l8r, 2.6 Å

PDB Description: the structure of plant photosystem i super-complex at 2.6 angstrom resolution.

PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d5l8r4_:

Sequence; same for both SEQRES and ATOM records:

>d5l8r4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kkgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmll
pevftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpi
fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd
nllqhisdpwhntivqtl

Timeline for d5l8r4_:

• d5l8r4_ first appeared in SCOPe 2.06
  
• d5l8r4_ appears in SCOPe 2.07