Lineage for d4r8xa2 (4r8x A:155-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966888Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2966889Protein automated matches [227009] (16 species)
    not a true protein
  7. 2966910Species Bacillus fastidiosus [TaxId:1458] [273141] (2 PDB entries)
  8. 2966912Domain d4r8xa2: 4r8x A:155-322 [273146]
    Other proteins in same PDB: d4r8xa3, d4r8xb3, d4r8xc3, d4r8xd3
    automated match to d1j2ga2

Details for d4r8xa2

PDB Entry: 4r8x (more details), 1.4 Å

PDB Description: crystal structure of a uricase from bacillus fastidious
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d4r8xa2:

Sequence, based on SEQRES records: (download)

>d4r8xa2 d.96.1.0 (A:155-322) automated matches {Bacillus fastidiosus [TaxId: 1458]}
sgtevveqasgiadiqlikvsgssfygyiideyttlaeatdrplyiflnigwayenqdda
kgdnpanyvaaeqvrdiaasvfhtldnksiqhliyhigltildrfpqltevnfgtnnrtw
dtvvegtdgfkgavfteprppfgfqgfsvhqedlarekasanseyval

Sequence, based on observed residues (ATOM records): (download)

>d4r8xa2 d.96.1.0 (A:155-322) automated matches {Bacillus fastidiosus [TaxId: 1458]}
sgtevveqasgiadiqlikvsgssfygyiideyttlaeatdrplyiflnigwayenqdda
kgdnpanyvaaeqvrdiaasvfhtldnksiqhliyhigltildrfpqltevnfgtnnrtw
dtvvegavfteprppfgfqgfsvhqedlarekasanseyval

SCOPe Domain Coordinates for d4r8xa2:

Click to download the PDB-style file with coordinates for d4r8xa2.
(The format of our PDB-style files is described here.)

Timeline for d4r8xa2: