Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
Protein automated matches [227009] (16 species) not a true protein |
Species Bacillus fastidiosus [TaxId:1458] [273141] (2 PDB entries) |
Domain d4r8xa2: 4r8x A:155-322 [273146] Other proteins in same PDB: d4r8xa3, d4r8xb3, d4r8xc3, d4r8xd3 automated match to d1j2ga2 |
PDB Entry: 4r8x (more details), 1.4 Å
SCOPe Domain Sequences for d4r8xa2:
Sequence, based on SEQRES records: (download)
>d4r8xa2 d.96.1.0 (A:155-322) automated matches {Bacillus fastidiosus [TaxId: 1458]} sgtevveqasgiadiqlikvsgssfygyiideyttlaeatdrplyiflnigwayenqdda kgdnpanyvaaeqvrdiaasvfhtldnksiqhliyhigltildrfpqltevnfgtnnrtw dtvvegtdgfkgavfteprppfgfqgfsvhqedlarekasanseyval
>d4r8xa2 d.96.1.0 (A:155-322) automated matches {Bacillus fastidiosus [TaxId: 1458]} sgtevveqasgiadiqlikvsgssfygyiideyttlaeatdrplyiflnigwayenqdda kgdnpanyvaaeqvrdiaasvfhtldnksiqhliyhigltildrfpqltevnfgtnnrtw dtvvegavfteprppfgfqgfsvhqedlarekasanseyval
Timeline for d4r8xa2: