Lineage for d4mrya_ (4mry A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1997383Protein automated matches [190064] (21 species)
    not a true protein
  7. 1997486Species Obelia longissima [TaxId:32570] [237068] (4 PDB entries)
  8. 1997487Domain d4mrya_: 4mry A: [237657]
    automated match to d1uhka_
    complexed with ca, cei; mutant

Details for d4mrya_

PDB Entry: 4mry (more details), 1.3 Å

PDB Description: crystal structure of ca(2+)- discharged y138f obelin mutant from obelia longissima at 1.30 angstrom resolution
PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d4mrya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mrya_ a.39.1.5 (A:) automated matches {Obelia longissima [TaxId: 32570]}
lktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcv
eaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkdgsg
titldewkafgkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadg
lygngvp

SCOPe Domain Coordinates for d4mrya_:

Click to download the PDB-style file with coordinates for d4mrya_.
(The format of our PDB-style files is described here.)

Timeline for d4mrya_: