Lineage for d1uhka_ (1uhk A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, openedSuperfamily a.39.1: EF-hand [47473] (12 families) 
Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
Duplication: made with two pairs of EF-hands
Protein automated matches [190064] (20 species)
not a true protein
Species Jellyfish (Aequorea victoria) [TaxId:6100] [186782] (4 PDB entries) 
Domain d1uhka_: 1uhk A: [119681]
automated match to d1ej3a_
complexed with czn
Details for d1uhka_
PDB Entry: 1uhk (more details), 1.6 Å
PDB Description: Crystal structure of n-aequorin
PDB Compounds: (A:) Aequorin 2SCOPe Domain Sequences for d1uhka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhka_ a.39.1.5 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
aceklyggavp
SCOPe Domain Coordinates for d1uhka_:
Click to download the PDB-style file with coordinates for d1uhka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uhka_:
- d1uhka_ first appeared in SCOP 1.73, called d1uhka1
- d1uhka_ appears in SCOPe 2.04
- d1uhka_ is called d1uhka2 in SCOPe 2.06
- d1uhka_ appears in the current release, SCOPe 2.08, called d1uhka2
View in 3D
