Lineage for d4mf7a2 (4mf7 A:104-233)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (36 species)
not a true protein
Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries) 
Domain d4mf7a2: 4mf7 A:104-233 [227814]
Other proteins in same PDB: d4mf7a1
automated match to d4ikha2
Details for d4mf7a2
PDB Entry: 4mf7 (more details), 1.8 Å
PDB Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domainSCOPe Domain Sequences for d4mf7a2:
Sequence, based on SEQRES records: (download)
>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv
learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa
vqrgleipkr
Sequence, based on observed residues (ATOM records): (download)
>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
flpadparrwqtlqwlhfqrplqryvaeskrllgvlearldgrqwimdadytiadiatlg
wvrnligfygarelvafdelthvpawlerglarpavqrgleipkr
SCOPe Domain Coordinates for d4mf7a2:
Click to download the PDB-style file with coordinates for d4mf7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4mf7a2:
- d4mf7a2 is new in SCOPe 2.03-stable
- d4mf7a2 appears in SCOPe 2.04
- d4mf7a2 appears in the current release, SCOPe 2.08
View in 3D
