SCOPe 2.03: Domain d4mf7a1: 4mf7 A:4-103

Lineage for d4mf7a1 (4mf7 A:4-103)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Bradyrhizobium sp. [TaxId:288000] [227810] (2 PDB entries)

8. Domain d4mf7a1: 4mf7 A:4-103 [227812]
   Other proteins in same PDB: d4mf7a2
   automated match to d4ikha1

Details for d4mf7a1

PDB Entry: 4mf7, 1.8 Å

PDB Description: Crystal structure of glutathione transferase BBTA-3750 from Bradyrhizobium sp., Target EFI-507290

PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4mf7a1:

Sequence; same for both SEQRES and ATOM records:

>d4mf7a1 c.47.1.0 (A:4-103) automated matches {Bradyrhizobium sp. [TaxId: 288000]}
lssfpitkrwpaqhsdriqlyslptpngvkvsimleetglpyephaidfgkdhqktpefl
slnpngkipaiidpngpgdkplglfesgailqylaektgq

Timeline for d4mf7a1:

• d4mf7a1 is new in SCOPe 2.03-stable
  
• d4mf7a1 appears in SCOPe 2.04
  
• d4mf7a1 appears in the current release, SCOPe 2.08