Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (41 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:288000] [227813] (2 PDB entries) |
Domain d4mf7a2: 4mf7 A:104-233 [227814] Other proteins in same PDB: d4mf7a1 automated match to d4ikha2 |
PDB Entry: 4mf7 (more details), 1.8 Å
SCOPe Domain Sequences for d4mf7a2:
Sequence, based on SEQRES records: (download)
>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]} flpadparrwqtlqwlhfqmggigpmfgqlgffhkfagreyedkrplqryvaeskrllgv learldgrqwimdadytiadiatlgwvrnligfygarelvafdelthvpawlerglarpa vqrgleipkr
>d4mf7a2 a.45.1.0 (A:104-233) automated matches {Bradyrhizobium sp. [TaxId: 288000]} flpadparrwqtlqwlhfqrplqryvaeskrllgvlearldgrqwimdadytiadiatlg wvrnligfygarelvafdelthvpawlerglarpavqrgleipkr
Timeline for d4mf7a2: